Recombinant Mouse IgG2B Protein
Product Sizes
20 ug
£145.00
RPT0025-20UG
100 ug
£276.00
RPT0025-100UG
500 ug
£764.00
RPT0025-500UG
1000 ug
£1193.00
RPT0025-1000UG
About this Product
- SKU:
- RPT0025
- Additional Names:
- Ighg2b,Igh-3,Ig gamma-2B chain C region ,Immunoglobulin heavy constant gamma 2B
- Extra Details:
- IgG2b,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.
- Formulation:
- Recombinant Mouse IgG2B Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97-Lys335) of Mouse IgG2b (Accession #P01867-2) fused with a Hi
- Immunogen:
- Glu97-Lys335
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- PSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0025
