Recombinant Human IgA1 Protein
Product Sizes
100 ug
£205.00
RPT0023-100UG
About this Product
- SKU:
- RPT0023
- Additional Names:
- Immunoglobulin heavy constant alpha 1,Ig alpha-1 chain C region,Ig alpha-1 chain C region BUR,Ig alpha-1 chain C region TRO ,IGHA1 ,IgA1
- Extra Details:
- Recombinant Recombinant Human IgA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys122-Tyr353) of Human IgA1 (Accession #P01876-1) fused with His tag at the N-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Cys122-Tyr353
- Molecular Weight:
- 26.27 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0023
