Recombinant Mouse IgG1 Protein
Product Sizes
50 ug
£145.00
RPT0017-50UG
100 ug
£193.00
RPT0017-100UG
500 ug
£526.00
RPT0017-500UG
1000 ug
£812.00
RPT0017-1000UG
About this Product
- SKU:
- RPT0017
- Additional Names:
- IgG1,Ighg1,Igh-4,Ig gamma-1 chain C region secreted form
- Extra Details:
- As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (5 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcG GammaR ) on phagocytic cells with high affinity.
- Formulation:
- Recombinant Mouse IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence Val98-Lys324 of MouseIgG1(Accession #P01868-1) fused with no tag.
- Immunogen:
- Val98-Lys324
- Molecular Weight:
- 30-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0017
