Recombinant Mouse IgG1 Protein
Product Sizes
50 ug
£145.00
RPT0017-50UG
About this Product
- SKU:
- RPT0017
- Additional Names:
- IgG1,Ighg1,Igh-4,Ig gamma-1 chain C region secreted form
- Extra Details:
- Recombinant Mouse IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence Val98-Lys324 of MouseIgG1(Accession #P01868-1) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Val98-Lys324
- Molecular Weight:
- 25.59 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0017
