Recombinant Human IgE Protein
Product Sizes
20 ug
£145.00
RPT0015-20UG
50 ug
£193.00
RPT0015-50UG
100 ug
£276.00
RPT0015-100UG
About this Product
- SKU:
- RPT0015
- Additional Names:
- Immunoglobulin heavy constant epsilon, Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE, IgE
- Extra Details:
- Recombinant Human IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser106-Gly427) of Human IgE (Accession #AAB59395.1 ) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser106-Gly427
- Molecular Weight:
- 38.60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0015
