Recombinant Mouse IgE Protein
Product Sizes
50 ug
£193.00
RPT0013-50UG
100 ug
£276.00
RPT0013-100UG
About this Product
- SKU:
- RPT0013
- Additional Names:
- IgE,Ig epsilon chain C region,Immunoglobulin heavy constant epsilon
- Extra Details:
- Recombinant Mouse IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro50-Lys388) of mouse IgE (Accession #) fused with and 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Pro50-Lys388
- Molecular Weight:
- 38.99 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PALGSELKVTTSQVTSWGKSAKNFTCHVTHPPSFNESRTILVRPVNITEPTLELLHSSCDPNAFHSTIQLYCFIYGHILNDVSVSWLMDDREITDTLAQTVLIKEEGKLASTCSKLNITEQQWMSESTFTCKVTSQGVDYLAHTRRCPDHEPRGVITYLIPPSPLDLYQNGAPKLTCLVVDLESEKNVNVTWNQEKKTSVSASQWYTKHHNNATTSITSILPVVAKDWIEGYGYQCIVDHPDFPKPIVRSITKTPGQRSAPEVYVFPPPEEESEDKRTLTCLIQNFFPEDISVQWLGDGKLISNSQHSTTTPLKSNGSNQGFFIFSRLEVAKTLWTQRK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0013
