Recombinant Yeast sumo Protein
Product Sizes
50 ug
£127.00
RPT0010-50UG
100 ug
£163.00
RPT0010-100UG
500 ug
£431.00
RPT0010-500UG
1000 ug
£622.00
RPT0010-1000UG
About this Product
- SKU:
- RPT0010
- Additional Names:
- sumo
- Conjugate:
- Biotin
- Extra Details:
- Recombinant Yeast sumo Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly98) of yeast sumo (Accession #NP_010798.1) fused with with His tag at the N-terminal.
- Formulation:
- Recombinant Yeast sumo Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly98) of yeast sumo (Accession #NP_010798.1) fused with with His tag at th
- Immunogen:
- Met1-Gly98
- Molecular Weight:
- 15-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RPT0010
