Recombinant Streptococcus SPG/IgG-binding protein G Protein
Product Sizes
50 ug
£145.00
RPT0009LQ-50UG
100 ug
£205.00
RPT0009LQ-100UG
500 ug
£551.00
RPT0009LQ-500UG
1000 ug
£837.00
RPT0009LQ-1000UG
About this Product
- SKU:
- RPT0009LQ
- Additional Names:
- IgG-binding protein G|Immunoglobulin G-binding protein G|SPG
- Extra Details:
- Protein G is a bacterial protein derived from the cell wall of certain strains of b-hemolytic Streptococcci. It binds with high affinity to the Fc portion of various classes and subclasses of immunoglobulins from a variety of species. Protein G binds to all IgG subclasses from human, mouse and rat species. It also binds to total IgG from guinea pig, rabbit, goat, cow, sheep, and horse. Protein G binds preferentially to the Fc portion of IgG, but can also bind to the Fab region, making it useful for purification of F(ab') fragments of IgG. Due to it's affinity for the Fc region of many mammalian immunoglobulins, protein G is considered a universal reagent in biochemistry and immunology.
- Formulation:
- Recombinant Streptococcus SPG/IgG-binding protein G Protein is produced by E. coli cells expression system.The target protein is expressed with sequence (Leu190-Lys384) of Streptococcus SPG/IgG-bindin
- Immunogen:
- Leu190-Lys384
- Molecular Weight:
- 25-30 kDa
- Purity:
- ≥95%
- Sequence:
- LDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLK
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RPT0009LQ
