Recombinant Human IgG3 Protein
Product Sizes
50 ug
£145.00
RPT0006-50UG
100 ug
£205.00
RPT0006-100UG
About this Product
- SKU:
- RPT0006
- Additional Names:
- IgG3,IGHG3,Immunoglobulin heavy constant gamma 3,Ig gamma-3 chain C region
- Extra Details:
- Recombinant Human IgG3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu99-Lys377) of human IgG3 (Accession #) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu99-Lys377
- Molecular Weight:
- 31.21 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0006
