Recombinant Human IgG2 Protein
Product Sizes
50 ug
£145.00
RPT0005-50UG
100 ug
£205.00
RPT0005-100UG
500 ug
£526.00
RPT0005-500UG
1000 ug
£812.00
RPT0005-1000UG
About this Product
- SKU:
- RPT0005
- Additional Names:
- IgG2|IGHG2|Immunoglobulin heavy constant gamma 2
- Extra Details:
- Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens
- Formulation:
- Recombinant Human IgG2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu99-Lys326) of human IgG2A (Accession # P01859) fused with no tag.
- Immunogen:
- Glu99-Lys326
- Molecular Weight:
- 30-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0005
