Recombinant Human IgG2 Protein
Product Sizes
50 ug
£145.00
RPT0005-50UG
100 ug
£205.00
RPT0005-100UG
About this Product
- SKU:
- RPT0005
- Additional Names:
- IgG2|IGHG2|Immunoglobulin heavy constant gamma 2
- Extra Details:
- Recombinant Human IgG2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu99-Lys326) of human IgG2A (Accession # P01859) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu99-Lys326
- Molecular Weight:
- 25.72 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0005
