Recombinant Human IgG1 Protein
Product Sizes
50 ug
£145.00
RPT0004-50UG
100 ug
£205.00
RPT0004-100UG
About this Product
- SKU:
- RPT0004
- Additional Names:
- Human IgG,IGHG1,human IgG (Fc),g gamma-1 chain C region
- Extra Details:
- Recombinant Human IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro100-Lys330) of human IgG1 Fc fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Pro100-Lys330
- Molecular Weight:
- 26.8 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Isotype Controls
- Manufacturer's Data Sheet:RPT0004
