Recombinant Aequorea victoria EGFP Protein
Product Sizes
20 ug
£145.00
RPT0003-20UG
50 ug
£193.00
RPT0003-50UG
100 ug
£276.00
RPT0003-100UG
500 ug
£764.00
RPT0003-500UG
1000 ug
£1193.00
RPT0003-1000UG
About this Product
- SKU:
- RPT0003
- Additional Names:
- Enhanced green fluorescent protein,EGFP
- Extra Details:
- GFP, also known as Green Fluorescent Protein, is a protein produced by the jellyfish (Aequorea Victoria) that produces bioluminescence in the green zone of the noticeable spectrum. Green Fluorescent Protein is a useful and ubiquitous instrument for producing chimeric proteins, where it functions as a fluorescent protein tag. GFP is expressed in most known cell types and is used as a noninvasive fluorescent marker in living cells and organisms. Green Fluorescent Protein permits a broad range of applications where it has functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Enhanced GFP (eGFP) has F64L and S65T mutations, which make GFP show increased fluorescence and fold more efficiently under 37°C.
- Formulation:
- Recombinant Aequorea victoria GFP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys238 (F64L,S65T)) of aequorea victoria GFP (Accession #)
- Immunogen:
- Met1-Lys238(F64L,S65T)
- Molecular Weight:
- 22-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RPT0003
