Recombinant Schistosoma japonicum GST-His Protein
Product Sizes
100 ug
£163.00
RPT0002-100UG
About this Product
- SKU:
- RPT0002
- Additional Names:
- GST 26|Sj26 antigen|SjGST
- Extra Details:
- Recombinant Schistosoma japonicum GST-His Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys218) of schistosoma japonicum GST-His fused with 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Lys218
- Molecular Weight:
- 26.34 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RPT0002




