Recombinant Schistosoma japonicum GST Protein
Product Sizes
100 ug
£163.00
RPT0001-100UG
500 ug
£431.00
RPT0001-500UG
1000 ug
£622.00
RPT0001-1000UG
About this Product
- SKU:
- RPT0001
- Additional Names:
- GST, GST 26, Sj26 antigen, SjGST
- Extra Details:
- GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.
- Formulation:
- Recombinant GST Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys218) of Schistosoma japonicum GST (Accession #P08515) fused with no tags.
- Immunogen:
- Met1-Lys218
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RPT0001
