Recombinant Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 protein
Product Sizes
20 ug
£223.00
RP10041LQ-20UG
50 ug
£336.00
RP10041LQ-50UG
100 ug
£508.00
RP10041LQ-100UG
500 ug
£1503.00
RP10041LQ-500UG
1000 ug
£2360.00
RP10041LQ-1000UG
About this Product
- SKU:
- RP10041LQ
- Additional Names:
- UBE2E1, UBCH6,Ubiquitin-conjugating enzyme E2 E1
- Extra Details:
- Ube2E1 is an E2 enzyme, which is part of the E1, E2, and E3 cascade responsible for ubiquitination of protein substrates. Ube2E1 was found to locate in the nucleus. It, along with Ube2D1, is known to complex with the E3 ligase Ro52 to ubiquitinate interferon regulatory transcription factors IRF3 and IRF8. Ube2E1 can also complex with a Ub ligase called RING105 to ubiquitinate a tumor suppressor known as tumor - suppressing subchromosomal transferable fragment cDNA (TSSC5).
- Formulation:
- Recombinant Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 protein is produced by E. coli cells expression system. The target protein is expressed with sequence (Ser2-Thr193) of Human Ubiquitin-conju
- Immunogen:
- Ser2-Thr193
- Molecular Weight:
- 20-30 kDa
- Purity:
- ≥95%
- Sequence:
- SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP10041LQ
