Recombinant Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 protein
Product Sizes
20 ug
£223.00
RP10041LQ-20UG
50 ug
£336.00
RP10041LQ-50UG
100 ug
£508.00
RP10041LQ-100UG
About this Product
- SKU:
- RP10041LQ
- Additional Names:
- UBE2E1, UBCH6,Ubiquitin-conjugating enzyme E2 E1
- Extra Details:
- Recombinant Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 protein is produced by E. coli cells expression system. The target protein is expressed with sequence (Ser2-Thr193) of Human Ubiquitin-conjugating enzyme E2 E1/UBE2E1 (Accession # P51965) fused with No tag .
- Formulation:
- 0.22 um filtered solution of 50 mM HEPES pH 7.5, 200 mM NaCl, 10% Glycerol (v/v), 1 mM TCEP.
- Immunogen:
- Ser2-Thr193
- Molecular Weight:
- 21.28 kDa
- Purity:
- ≥95%
- Sequence:
- SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP10041LQ
