Recombinant Mouse CD55 Protein
Product Sizes
10 ug
£133.00
RP03522-10UG
20 ug
£181.00
RP03522-20UG
50 ug
£240.00
RP03522-50UG
100 ug
£353.00
RP03522-100UG
500 ug
£1002.00
RP03522-500UG
1000 ug
£1574.00
RP03522-1000UG
About this Product
- SKU:
- RP03522
- Additional Names:
- Cd55, Cd55a, Daf, Daf1,Complement decay-accelerating factor, GPI-anchored, DAF-GPI, CD55
- Extra Details:
- Recombinant Mouse CD55 Protein is a major regulator of the alternative and classical pathways of complement activation and is expressed on all serum-exposed cells.This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.
- Formulation:
- Recombinant Mouse CD55 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Asp35-Gly362) of Mouse CD55(Accession #NP_034146.2) fused with His tag at the C-Termin
- Immunogen:
- Asp35-Gly362
- Molecular Weight:
- 40-66 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNTG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03522
