Recombinant Human Phospholipase A2/PLA2G1B Protein
Product Sizes
10 ug
£145.00
RP03277-10UG
20 ug
£193.00
RP03277-20UG
50 ug
£288.00
RP03277-50UG
100 ug
£431.00
RP03277-100UG
About this Product
- SKU:
- RP03277
- Additional Names:
- Phospholipase A2|PLA2|PLA2A|PLA2G1B|PPLA2
- Extra Details:
- Recombinant Human Phospholipase A2/PLA2G1B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ser148) of human Phospholipase A2/PLA2G1B (Accession #NP_000919.1) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 10 mM Tris, 5 mM CaCl2, pH 8.0. Contact us for customized product form or formulation.
- Immunogen:
- Met1-Ser148
- Molecular Weight:
- 17.20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP03277
