Recombinant Human Inhibin beta E/INHBE Protein
Product Sizes
20 ug
£193.00
RP03275-20UG
50 ug
£288.00
RP03275-50UG
100 ug
£431.00
RP03275-100UG
About this Product
- SKU:
- RP03275
- Additional Names:
- INHBE,Inhibin beta E chain, Activin beta-E chain
- Extra Details:
- Recombinant Human Inhibin beta E/INHBE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr237-Ser350) of human Inhibin beta E/INHBE (Accession #NP_113667.1) fused with hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Thr237-Ser350
- Molecular Weight:
- 39.39 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03275
