Recombinant Human Retinol-binding protein 3/RBP3 Protein
Product Sizes
10 ug
£145.00
RP03269-10UG
50 ug
£336.00
RP03269-50UG
About this Product
- SKU:
- RP03269
- Additional Names:
- Interphotoreceptor retinoid-binding protein|Interstitial retinol-binding protein|IRBP|RBP3|Retinol-binding protein 3
- Extra Details:
- Recombinant Human Retinol-binding protein 3/RBP3 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Thr321-Leu630) of human RBP3 (Accession #P10745) fused with His tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Thr321-Leu630
- Molecular Weight:
- 35.2 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03269
