Recombinant Human Retinol-binding protein 3/RBP3 Protein
Product Sizes
10 ug
£145.00
RP03269-10UG
50 ug
£336.00
RP03269-50UG
500 ug
£1478.00
RP03269-500UG
1000 ug
£2430.00
RP03269-1000UG
About this Product
- SKU:
- RP03269
- Additional Names:
- Interphotoreceptor retinoid-binding protein|Interstitial retinol-binding protein|IRBP|RBP3|Retinol-binding protein 3
- Extra Details:
- Retinol-binding proteins (RBP) are carrier proteins that bind retinol. Retinol and retinoic acid play crucial roles in the modulation of gene expression and overall development of an embryo. However, deficit or excess of either one of these substances can cause early embryo mortality or developmental malformations. Regulation of transport and metabolism of retinol necessary for a successful pregnancy is accomplished via RBP. Retinol binding proteins have been identified within the uterus, embryo, and extraembryonic tissue of the bovine, ovine, and porcine, clearly indicating that RBP plays a role in proper retinol exposure to the embryo and successful transport at the maternal-fetal interface.
- Formulation:
- Recombinant Human Retinol-binding protein 3/RBP3 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Thr321-Leu630) of human RBP3 (Accession #P10745) fused
- Immunogen:
- Thr321-Leu630
- Molecular Weight:
- 38&75-80 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03269
