Recombinant Human R-spondin-2/RSPO2 Protein
Product Sizes
10 ug
£193.00
RP03266-10UG
20 ug
£258.00
RP03266-20UG
50 ug
£383.00
RP03266-50UG
100 ug
£586.00
RP03266-100UG
500 ug
£1716.00
RP03266-500UG
1000 ug
£2716.00
RP03266-1000UG
About this Product
- SKU:
- RP03266
- Additional Names:
- R-spondin-2, Roof plate-specific spondin-2, hRspo2,RSPO2, UNQ9384/PRO34209
- Extra Details:
- R-spondins are secretory proteins localized in the endoplasmic reticulum and Golgi bodies and are processed through the secretory pathway. The RSPO family comprises four proteins, i.e., R-spondin 1-4, which are important secreted regulators of the Wnt/-catenin and Wnt/PCP signaling pathway and govern various functions and are involved in vital cellular processes such as stem cell renewal, morphogenesis and, tumorigenesis. Among the R-spondin family, R-spondin-2, is a key protein that regulates ligand-dependent -catenin signaling. And it has been reported to play a pivotal role in myogenesis, osteoblast differentiation, and limb specification during embryonic development.
- Formulation:
- Recombinant Human R-spondin-2/RSPO2 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala32-Gly205) of human R-spondin-2 (Accession #Q6UXX9) fused with
- Immunogen:
- Ala32-Gly205
- Molecular Weight:
- 55-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03266
