Recombinant Human R-spondin-2/RSPO2 Protein
Product Sizes
10 ug
£193.00
RP03266-10UG
20 ug
£258.00
RP03266-20UG
50 ug
£383.00
RP03266-50UG
100 ug
£586.00
RP03266-100UG
About this Product
- SKU:
- RP03266
- Additional Names:
- R-spondin-2, Roof plate-specific spondin-2, hRspo2,RSPO2, UNQ9384/PRO34209
- Extra Details:
- Recombinant Human R-spondin-2/RSPO2 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ala32-Gly205) of human R-spondin-2 (Accession #Q6UXX9) fused with hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala32-Gly205
- Molecular Weight:
- 47.66 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03266
