Recombinant Canine CXCL12/SDF-1 Protein
Product Sizes
50 ug
£478.00
RP03263-50UG
About this Product
- SKU:
- RP03263
- Additional Names:
- C-X-C motif chemokine 12|CXCL12|SDF-1|Stromal cell-derived factor 1
- Extra Details:
- Recombinant Canine CXCL12/SDF-1 Protein is produced by E. coli expression system. The target protein is expressed with sequence(Lys22-Met93) of Canine CXCL12/SDF-1 (Accession #NP_001121569.1) fused with No tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50 mM Tris, 500 mM NaCl, pH 8.0. Contact us for customized product form or formulation.
- Immunogen:
- Lys22-Met93
- Molecular Weight:
- 8.6 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNKRFKM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03263
