Recombinant Mouse Siglec-10 Protein
Product Sizes
10 ug
£163.00
RP03262-10UG
50 ug
£431.00
RP03262-50UG
About this Product
- SKU:
- RP03262
- Additional Names:
- MGC126774|PRO940|sialic acid-binding Ig-like lectin 10|Siglec-10|Siglec-G|siglec-like gene 2|Siglec-like protein 2|SIGLEC10|SiglecG|SLG2|SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7
- Extra Details:
- Recombinant Mouse Siglec-10 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met19-Lys543) of mouse Siglec-10 (Accession #Q80ZE3) fused with hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Met19-Lys543
- Molecular Weight:
- 85.6 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03262
