Recombinant Mouse Siglec-10 Protein
Product Sizes
10 ug
£163.00
RP03262-10UG
50 ug
£431.00
RP03262-50UG
500 ug
£1716.00
RP03262-500UG
1000 ug
£2906.00
RP03262-1000UG
About this Product
- SKU:
- RP03262
- Additional Names:
- MGC126774|PRO940|sialic acid-binding Ig-like lectin 10|Siglec-10|Siglec-G|siglec-like gene 2|Siglec-like protein 2|SIGLEC10|SiglecG|SLG2|SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7
- Extra Details:
- Siglecs (sialic acid binding Ig-like lectins) belong to the immunoglobulin superfamily. Siglec-G is the apparent ortholog of human Siglec-10. It is expressed by mature B cells, but significant levels of transcript were also detected in DC, myeloid cells, and to a lesser extent, T cells. Mature Siglec-G consists of a 526 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 124 aa cytoplasmic domain. Siglec-G is a member of the CD33-related Siglec family in the mouse, and is involved in negative regulation of B-cell antigen receptor signaling and specifically acts on B1 cells to inhibit Ca2+ signaling, cellular expansion and antibody secretion.
- Formulation:
- Recombinant Mouse Siglec-10 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Met19-Lys543) of mouse Siglec-10 (Accession #Q80ZE3) fused with hFc tag a
- Immunogen:
- Met19-Lys543
- Molecular Weight:
- 110-135 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03262
