Recombinant Human Histone H2A Protein
Product Sizes
100 ug
£431.00
RP03260-100UG
500 ug
£1240.00
RP03260-500UG
1000 ug
£2430.00
RP03260-1000UG
About this Product
- SKU:
- RP03260
- Additional Names:
- H2AC25|H2AW|HIST3H2A|Histone H2A type 3
- Extra Details:
- HIST3H2A is a member of histones, which are a complex family of highly conserved basic proteins responsible for packaging chromosomal DNA into nucleosomes. Covalent modification of histones is important in regulating chromatin dynamics and transcription. One example of such modification is ubiquitination, which mainly occurs on histones H2A and H2B. E3 ubiquitin ligase complex is specific for histone H2A (HIST3H2A). Reducing the expression of Ring2 results in a dramatic decrease in the level of ubiquitinated H2A in HeLa cells. DNA damage induces monoubiquitylation of histone H2A (HIST3H2A) in the vicinity of DNA lesions.
- Formulation:
- Recombinant Human HIST3H2A Protein is produced by E.coli expression system. The target protein is expressed with sequence (Ser2-Lys130) of human HIST3H2A (Accession #NP_254280.1) fused with No tag.
- Immunogen:
- Ser2-Lys130
- Molecular Weight:
- 15-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03260
