Recombinant Human Histone H2A Protein
Product Sizes
100 ug
£431.00
RP03260-100UG
About this Product
- SKU:
- RP03260
- Additional Names:
- H2AC25|H2AW|HIST3H2A|Histone H2A type 3
- Extra Details:
- Recombinant Human HIST3H2A Protein is produced by E.coli expression system. The target protein is expressed with sequence (Ser2-Lys130) of human HIST3H2A (Accession #NP_254280.1) fused with No tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Ser2-Lys130
- Molecular Weight:
- 13.99 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03260
