Recombinant Human NUDT5 Protein
Product Sizes
100 ug
£395.00
RP03258-100UG
About this Product
- SKU:
- RP03258
- Additional Names:
- ADP-sugar pyrophosphatase|HSPC115|Nudix motif 5|NUDIX5|NUDT5|YSA1|YSA1H
- Extra Details:
- Recombinant Human NUDT5 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Phe219) of human NUDT5 (Accession #Q9UKK9) fused with His tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Met1-Phe219
- Molecular Weight:
- 25.29 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP03258




