Recombinant Human NDRG1 Protein
Product Sizes
100 ug
£431.00
RP03256-100UG
About this Product
- SKU:
- RP03256
- Additional Names:
- CAP43|CMT4D|Differentiation-related gene 1 protein|DRG1|GC4|HMSNL|N-myc downstream-regulated gene 1 protein|NDR1|NDRG1|NMSL|PROXY1|Reducing agents and tunicamycin-responsive protein|RIT42|RTP|TARG1|TDD5
- Extra Details:
- Recombinant Human NDRG1 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys394) of human NDRG1 (Accession #Q92597) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Met1-Cys394
- Molecular Weight:
- 43.8 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03256
