Recombinant Human REG3G Protein
Product Sizes
50 ug
£526.00
RP03255-50UG
About this Product
- SKU:
- RP03255
- Additional Names:
- Pancreatitis-associated protein 1B|PAP1B|REG-3-gamma|REG3G|Regenerating islet-derived protein 3-gamma
- Extra Details:
- Recombinant Human REG3G Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp175) of human REG3G (Accession #Q6UW15) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Met1-Asp175
- Molecular Weight:
- 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP03255
