Recombinant Human ABHD4 Protein
Product Sizes
20 ug
£288.00
RP03195-20UG
100 ug
£591.00
RP03195-100UG
About this Product
- SKU:
- RP03195
- Additional Names:
- ABHD4,(Lyso)-N-acylphosphatidylethanolamine lipase, 3.1.1.-, Alpha/beta hydrolase domain-containing protein 4, Abhydrolase domain-containing protein 4, Alpha/beta-hydrolase 4
- Extra Details:
- Recombinant Human ABHD4 Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Asp342) of Human ABHD4 (Accession #NP_071343.2) fused with a His tag at the N-terminus.
- Formulation:
- Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0.
- Immunogen:
- Met1-Asp342
- Molecular Weight:
- 40 kDa.
- Physical State:
- Lyophilized
- Purity:
- 80%
- Sequence:
- MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP03195
