Recombinant Mouse FGF-7/HBGF-7/KGF Protein
Product Sizes
10 ug
£145.00
RP03172-10UG
20 ug
£193.00
RP03172-20UG
50 ug
£288.00
RP03172-50UG
100 ug
£431.00
RP03172-100UG
About this Product
- SKU:
- RP03172
- Additional Names:
- Fibroblast growth factor 7,FGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,Fgf7,Fgf-7, Kgf
- Extra Details:
- Recombinant Recombinant Mouse FGF-7/HBGF-7/KGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys32-Thr194) of Mouse FGF-7/HBGF-7/KGF (Accession #NP_032034.1) fused with no tag .
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Cys32-Thr194
- Molecular Weight:
- 18.75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03172
