Recombinant Mouse Amphiregulin/AREG Protein
Product Sizes
100 ug
£395.00
RP03167-100UG
About this Product
- SKU:
- RP03167
- Additional Names:
- AREG,AR,AREGB,CRDGF,SDGF,amphiregulin
- Extra Details:
- Recombinant Mouse Amphiregulin/AREG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val100-Ala248) of Mouse Amphiregulin/AREG (Accession #NP_033834.1) fused with hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Val100-Ala248
- Molecular Weight:
- 38.6 kda
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Sequence:
- VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQENGTVHAIA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03167
