Recombinant Mouse Amphiregulin/AREG Protein
Product Sizes
100 ug
£395.00
RP03167-100UG
500 ug
£1157.00
RP03167-500UG
1000 ug
£2258.00
RP03167-1000UG
About this Product
- SKU:
- RP03167
- Additional Names:
- AREG,AR,AREGB,CRDGF,SDGF,amphiregulin
- Extra Details:
- Amphiregulin (AREG) is a ligand of the epidermal growth factor receptor (EGFR), a widely expressed transmembrane tyrosine kinase. AREG is synthesized as a membrane-anchored precursor protein that can engage in juxtacrine signaling on adjacent cells. Alternatively, after proteolytic processing by cell membrane proteases, mainly TACE/ADAM17, AREG is secreted and behaves as an autocrine or paracrine factor.
- Formulation:
- Recombinant Mouse Amphiregulin/AREG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val100-Ala248) of Mouse Amphiregulin/AREG (Accession #NP_03383
- Immunogen:
- Val100-Ala248
- Molecular Weight:
- 45-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Sequence:
- VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQENGTVHAIA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03167
