Recombinant Mouse PDGF-AA Protein
Product Sizes
50 ug
£574.00
RP03145-50UG
About this Product
- SKU:
- RP03145
- Additional Names:
- PDGF-A|PDGF1|PDGFA
- Extra Details:
- Recombinant Mouse PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Arg196) of Mouse PDGF-AA (Accession #NP_032834.1) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 0.1% TFA, 30% CAN. Contact us for customized product form or formulation.
- Immunogen:
- Ser87-Arg196
- Molecular Weight:
- 14.5 kDa.
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03145
