Recombinant Human Caspase-7/CASP7 Protein
Product Sizes
10 ug
£193.00
RP03142-10UG
20 ug
£288.00
RP03142-20UG
50 ug
£431.00
RP03142-50UG
100 ug
£657.00
RP03142-100UG
500 ug
£1954.00
RP03142-500UG
1000 ug
£3097.00
RP03142-1000UG
About this Product
- SKU:
- RP03142
- Additional Names:
- CASP7, MCH3,Caspase-7, CASP-7, EC:3.4.22.60, Apoptotic protease Mch-3, CMH-1, ICE-like apoptotic protease 3, ICE-LAP3, Cleaved into: Caspase-7 subunit p20, Caspase-7 subunit p11
- Extra Details:
- Caspase-7/CASP7 belongs to the cysteine-aspartic acid protease (caspase) family. Caspases play a role in the signal transduction pathways of apoptosis, necrosis and inflammation. There are two major classes of caspases: initiators and effectors. The initiator isoformsare activated by, and interact with, upstream adaptor molecules through protein-protein interaction domains known as CARD and DED. Effector caspases are responsible for cleaving downstream substrates and are sometimes referred to as the executioner caspases. Caspase 7 exists in lung, skeletal muscle, liver, kidney, spleen, heart, and moderately in testis. Caspase 7 cannot be detected in the brain. Caspase 7 functions in the activation cascade of caspases responsible for apoptosis execution. It cleaves and activates sterol regulatory element binding proteins (SREBPs). It proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp- -Gly-217' bond. Overexpression promotes programmed cell death.
- Formulation:
- Recombinant Human Caspase-7/CASP7 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gln303) of Human Caspase-7/CASP7(Accession #NP_001218.1) fused w
- Immunogen:
- Met1-Gln303
- Molecular Weight:
- 20, 11 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP03142
