Recombinant Mouse Complement C5A Protein
Product Sizes
100 ug
£526.00
RP03137-100UG
About this Product
- SKU:
- RP03137
- Additional Names:
- complement component 5, C5a
- Extra Details:
- Recombinant C5a Protein is produced by Ecoli expression system. The target protein is expressed with sequence (Asn679-Arg755) of mouse C5a (Accession #NP_034536.2) fused with an initial Met.
- Formulation:
- Lyophilized from sterile PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Asn679-Arg755
- Molecular Weight:
- 9 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- MNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03137
