Recombinant Human CDC42 Protein
Product Sizes
100 ug
£526.00
RP03136-100UG
About this Product
- SKU:
- RP03136
- Additional Names:
- CDC42, CDC42Hs Protein, G25K Protein
- Extra Details:
- Recombinant Human CDC42 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys188) of human CDC42 (Accession #P60953-2) fused with a GST tag at the N-terminus.
- Formulation:
- Lyophilized from sterile 20mM Tris, 0.15M NaCl, 0.5mM GSH, pH 8.0. Contact us for customized product form or formulation.
- Immunogen:
- Met1-Cys188
- Molecular Weight:
- 48.1 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP03136
