Recombinant Mouse IL-2 R beta/CD122 Protein
Product Sizes
50 ug
£574.00
RP03105-50UG
About this Product
- SKU:
- RP03105
- Additional Names:
- CD122|IL-15Rbeta|Il-2/15Rbeta|Il-2Rbeta|IL15Rbeta|p70
- Extra Details:
- Recombinant Mouse IL-2 R beta/CD122 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Glu240) of Mouse IL-2 R beta/CD122 (Accession #NP_032394.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Ala27-Glu240
- Molecular Weight:
- 26.5 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03105




