Recombinant Human EG-VEGF/PK1 Protein
Product Sizes
50 ug
£336.00
RP03103-50UG
About this Product
- SKU:
- RP03103
- Additional Names:
- EG-VEGF, PK1, PRK1
- Extra Details:
- Recombinant Human Prokineticin-1/EG-VEGF Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Phe105) of human Prokineticin-1/EG-VEGF (Accession # NP_115790.1) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Phe105
- Molecular Weight:
- 11kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03103
