Recombinant Mouse Ephrin-A4/EFNA4 Protein
Product Sizes
10 ug
£133.00
RP03100-10UG
20 ug
£181.00
RP03100-20UG
50 ug
£240.00
RP03100-50UG
100 ug
£353.00
RP03100-100UG
About this Product
- SKU:
- RP03100
- Additional Names:
- Efna4, Epl4, Eplg4, Lerk4
- Extra Details:
- Recombinant Mouse Ephrin-A4/EFNA4 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Leu26 - Gly176) of Mouse Ephrin-A4/EFNA4(Accession #NP_031936.2) fused with hFC at the C-Terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4).
- Immunogen:
- Leu26 - Gly176
- Molecular Weight:
- 43.67 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP03100
