Recombinant Mouse Cathepsin B Protein
Product Sizes
50 ug
£574.00
RP02994-50UG
About this Product
- SKU:
- RP02994
- Additional Names:
- Cathepsin B, 3.4.22.1, APP secretase, APPS, Cathepsin B1,CTSB
- Extra Details:
- Recombinant Mouse Cathepsin B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Phe339) of mouse Cathepsin B (Accession #NP_031824.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Recombinant Mouse Cathepsin B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Phe339) of mouse Cathepsin B (Accession #NP_031824.1) fused wi
- Immunogen:
- His18-Phe339
- Molecular Weight:
- 35-43 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP02994
