Recombinant Human CISD1 Protein
Product Sizes
100 ug
£621.00
RP02993-100UG
About this Product
- SKU:
- RP02993
- Additional Names:
- C10orf70|MDS029|mitoNEET|ZCD1
- Extra Details:
- Recombinant Human CISD1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys32-Thr108) of human CISD1 (Accession #NP_060934.1) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
- Immunogen:
- Lys32-Thr108
- Molecular Weight:
- 11.3 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP02993
