Recombinant Human Fibrillin-1/FBN1 Protein
Product Sizes
10 ug
£193.00
RP02988-10UG
50 ug
£478.00
RP02988-50UG
About this Product
- SKU:
- RP02988
- Additional Names:
- Asprosin|Fbn-1|Fbn1|Fibrillin-1
- Extra Details:
- Recombinant Human Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2732-His2871) of human Fibrillin-1/FBN1 (Accession #NP_000129.3) fused with a 8xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser2732-His2871
- Molecular Weight:
- 17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02988
