Recombinant Human Microfibrillar-associated protein 5 Protein
Product Sizes
100 ug
£621.00
RP02966-100UG
About this Product
- SKU:
- RP02966
- Additional Names:
- AAT9|MAGP-2|MAGP2|MFAP-5|MP25
- Extra Details:
- Recombinant Human Microfibrillar-associated protein 5 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Met1-Leu173) of human Microfibrillar-associated protein 5 (Accession #NP_003471.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from sterile PBS, pH 7.4
- Immunogen:
- Met1-Leu173
- Molecular Weight:
- 18.7 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02966
