Recombinant Mouse VSIG4 Protein
Product Sizes
10 ug
£145.00
RP02949-10UG
50 ug
£288.00
RP02949-50UG
About this Product
- SKU:
- RP02949
- Additional Names:
- VSIG4,CRIg,Z39IG
- Extra Details:
- Recombinant Mouse VSIG4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His20-Pro187) of mouse VSIG4 (Accession #NP_808457.1) fused with 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- His20-Pro187
- Molecular Weight:
- 19.7 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02949
