Recombinant Mouse VSIG4 Protein
Product Sizes
10 ug
£145.00
RP02949-10UG
50 ug
£288.00
RP02949-50UG
500 ug
£1478.00
RP02949-500UG
1000 ug
£1954.00
RP02949-1000UG
About this Product
- SKU:
- RP02949
- Additional Names:
- VSIG4,CRIg,Z39IG
- Extra Details:
- V-set and immunoglobulin domain containing 4 (VSIG4) is a type I transmembrane glycoprotein that is a B7 family-related protein and an Ig superfamily member. Mouse VSIG4 is synthesized as a 280 amino acid (aa) precursor that contains a signal sequence, an IgV-type immunological domain (aa 36-115),one potential N-linked glycosylation site, and a single transmembrane domain. The IgV domain of mouse VSIG4 shares 86% and 80% aa sequence identity with the IgV domains of rat and human VSIG4, respectively. VSIG4 functions as a negative regulator of mouse as well as human T cell activation, and may be involved in the maintenance of peripheral T cell tolerance and/or unresponsiveness. VSIG4 acts as a macrophage complement receptor by binding complement fragments C3b and iC3b. VSIG4 binding to C3b inhibits complement activation through the alternative pathway, making it a potent suppressor of established inflammation.
- Formulation:
- Recombinant Mouse VSIG4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His20-Pro187) of mouse VSIG4 (Accession #NP_808457.1) fused with 6xHis tag
- Immunogen:
- His20-Pro187
- Molecular Weight:
- 28-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02949
