Recombinant Mouse IL-22 Protein
Product Sizes
10 ug
£163.00
RP02942-10UG
20 ug
£223.00
RP02942-20UG
50 ug
£336.00
RP02942-50UG
100 ug
£508.00
RP02942-100UG
About this Product
- SKU:
- RP02942
- Additional Names:
- IL-22,If2b1,Iltif,IL-22a, ILTIFa,IL22
- Extra Details:
- Recombinant Mouse IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu34-Val179) of mouse IL-22 (Accession #NP_058667.1) fused with 6xHis at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu34-Val179
- Molecular Weight:
- 17.48 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02942
