Recombinant Mouse uPAR/PLAUR/CD87 Protein
Product Sizes
100 ug
£336.00
RP02934-100UG
About this Product
- SKU:
- RP02934
- Additional Names:
- CD87,U-PAR,UPAR,URKR
- Extra Details:
- Recombinant Mouse uPAR/PLAUR/CD87 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Gly298) of mouse uPAR/PLAUR/CD87 (Accession #NP_035243.1) fused with 6xHis, Avi tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Leu24-Gly298
- Molecular Weight:
- 32.92 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Sequence:
- LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02934
