Recombinant Mouse uPAR/PLAUR/CD87 Protein
Product Sizes
100 ug
£336.00
RP02934-100UG
500 ug
£1002.00
RP02934-500UG
1000 ug
£1764.00
RP02934-1000UG
About this Product
- SKU:
- RP02934
- Additional Names:
- CD87,U-PAR,UPAR,URKR
- Extra Details:
- The secreted recombinant human UPAR consists of 292 amino acids with a molecular weight of 32.8 kDa. Recombinant human UPAR migrates as an about 48 kDa band in SDS-PAGE under reducing conditions due to glycosylation.Urokinase plasminogen activator surface receptor (U-PAR) is also known as PLAUR, Monocyte activation antigen Mo3, CD antigen CD87. U-PAR contains three UPAR/Ly6 domains and is expressed in neurons of the rolandic area of the brain (at protein level). PLAUR / UPAR acts as a receptor for urokinase plasminogen activator and plays a role in localizing and promoting plasmin formation. Urokinase plasminogen activator (uPA) and/or its receptor (uPAR) are essential for metastasis, and overexpression of these molecules is strongly correlated with poor prognosis in a variety of malignant tumours. Furthermore, the analysis of U-PAR expression has a potential role in the diagnostic or prognostic work-up of several hematological malignancies, particularly acute leukemia and multiple myeloma.
- Formulation:
- Recombinant Mouse uPAR/PLAUR/CD87 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Gly298) of mouse uPAR/PLAUR/CD87 (Accession #NP_035243.1)
- Immunogen:
- Leu24-Gly298
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Sequence:
- LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02934
