Recombinant Mouse Leptin/LEP Protein
Product Sizes
100 ug
£145.00
RP02880-100UG
About this Product
- SKU:
- RP02880
- Additional Names:
- FLJ94114|LEP|Leptin|leptin (murine obesity homolog)|leptin (obesity homolog, mouse)|OB|Obese protein|obese, mouse, homolog of|Obesity factor|OBOBS
- Extra Details:
- Recombinant Mouse Leptin/LEP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of mouse Leptin (Accession #NP_032519.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM PB, 300mM NaCl, pH7.4.
- Immunogen:
- Val22-Cys167
- Molecular Weight:
- 16.00 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02880
