Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Recombinant Mouse Leptin/LEP Protein

Product Sizes
100 ug
£145.00
RP02880-100UG
500 ug
£354.00
RP02880-500UG
1000 ug
£509.00
RP02880-1000UG
About this Product
SKU:
RP02880
Additional Names:
FLJ94114|LEP|Leptin|leptin (murine obesity homolog)|leptin (obesity homolog, mouse)|OB|Obese protein|obese, mouse, homolog of|Obesity factor|OBOBS
Extra Details:
Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse and rat cells. Mouse Leptin shares approximately 96% and 84% sequence identity with the rat and human protein, respectively. Mouse Leptin cDNA encodes a 167 amino acid residue protein with a 21 amino acid residue signal sequence that is cleaved to yield the 146 amino acid residue mature protein. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. A high-affinity receptor for Leptin (OB-R) with homology to gp130 and the G-CSF receptor has been cloned. OB-R mRNA has been shown to be expressed in the choroid plexus and in the hypothalamus. OB-R has also been identified as an isoform of B219, a sequence that is expressed in at least four isoforms in very primitive hematopoietic cell populations and in a variety of lymphohematopoietic cell lines (1-3). The possible roles of Leptin in body weight regulation, hematopoiesis and reproduction are being investigated.
Formulation:
Recombinant Mouse Leptin/LEP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of mouse Leptin (Accession #NP_032519.1) fused with no addit
Immunogen:
Val22-Cys167
Molecular Weight:
15-20 kDa
Physical State:
Lyophilized
Purity:
≥95%
Sequence:
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
ABclonal Technology
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins