Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein

Product Sizes

10 ug

£193.00

RP02873-10UG

50 ug

£478.00

RP02873-50UG

500 ug

£2192.00

RP02873-500UG

About this Product

SKU:: RP02873
Additional Names:: CGB3,CGB,CGB5,CGB7,CGB8,hCGB
Extra Details:: Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
Formulation:: Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Gln165) of Human Choriogonadotropin
Immunogen:: Ser21-Gln165
Molecular Weight:: 28-35 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket