Recombinant Mouse DLK1 Protein
Product Sizes
100 ug
£353.00
RP02871-100UG
500 ug
£1336.00
RP02871-500UG
1000 ug
£1954.00
RP02871-1000UG
About this Product
- SKU:
- RP02871
- Additional Names:
- DLK|DLK-1|DLK1|FA1|pG2|Pref1|secredeltin|ZOG
- Extra Details:
- paternally inherited genetic defects of DLK1 were identified in four families with nonsyndromic CPP and a metabolic phenotype. DLK1 encodes a transmembrane protein that is important for adipose tissue homeostasis and neurogenesis and is located in the imprinted chromosome 14q32 region associated with Temple syndrome.
- Formulation:
- Recombinant Mouse DLK1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gln305) of Mouse DLK1 (Accession #NP_034182.2) fused with 6xHis tag a
- Immunogen:
- Ala24-Gln305
- Molecular Weight:
- 50-68 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Sequence:
- AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02871
