Recombinant Human beta Defensin 3/DEFB103A Protein
Product Sizes
100 ug
£621.00
RP02867-100UG
About this Product
- SKU:
- RP02867
- Additional Names:
- BD-3|Beta-defensin 3|DEFB-3|DEFB103A|hBD-3|HBD3
- Extra Details:
- Recombinant Human beta Defensin 3/DEFB103A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly23-Lys67) of human beta Defensin 3/DEFB103A (Accession #NP_061131.1) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM Tris, 0.3% Ttiton X-100, 0.3% SKL, pH 8.5.
- Immunogen:
- Gly23-Lys67
- Molecular Weight:
- 7.3 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02867
