Recombinant Mouse Midkine/MDK Protein
Product Sizes
10 ug
£133.00
RP02865-10UG
20 ug
£181.00
RP02865-20UG
50 ug
£240.00
RP02865-50UG
100 ug
£353.00
RP02865-100UG
500 ug
£1002.00
RP02865-500UG
1000 ug
£1574.00
RP02865-1000UG
About this Product
- SKU:
- RP02865
- Additional Names:
- ARAP|MDK|MEK|MK|MK1|MKARAP|NEGF2
- Extra Details:
- Midkine is a heparin-binding growth factor, originally reported as the product of a retinoic acid-responsive gene during embryogenesis, but currently viewed as a multifaceted factor contributing to both normal tissue homeostasis and disease development. Midkine is abnormally expressed at high levels in various human malignancies and acts as a mediator for the acquisition of critical hallmarks of cancer, including cell growth, survival, metastasis, migration, and angiogenesis.
- Formulation:
- Recombinant Mouse Midkine/MDK Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys23-Asp140) of mouse Midkine (Accession #NP_001012335.1) fused with no
- Immunogen:
- Lys23-Asp140
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02865
