Recombinant Human CD7 Protein
Product Sizes
10 ug
£133.00
RP02864-10UG
50 ug
£240.00
RP02864-50UG
500 ug
£1002.00
RP02864-500UG
1000 ug
£1574.00
RP02864-1000UG
About this Product
- SKU:
- RP02864
- Additional Names:
- CD7 molecule|GP40|LEU-9|Tp40|TP41
- Extra Details:
- CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.
- Formulation:
- Recombinant Human CD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Pro180) of human CD7 (Accession #NP_006128.1) fused with a hFc tag at
- Immunogen:
- Ala26-Pro180
- Molecular Weight:
- 55-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02864
