Recombinant Mouse LRG1 Protein
Product Sizes
10 ug
£127.00
RP02863-10UG
20 ug
£175.00
RP02863-20UG
50 ug
£240.00
RP02863-50UG
100 ug
£336.00
RP02863-100UG
500 ug
£1002.00
RP02863-500UG
1000 ug
£1574.00
RP02863-1000UG
About this Product
- SKU:
- RP02863
- Additional Names:
- LRG1,HMFT1766,LRG
- Extra Details:
- Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.
- Formulation:
- Recombinant Mouse LRG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu33-Leu342) of mouse LRG1 (Accession #NP_084072.1) fused with a 6xHis tag
- Immunogen:
- Leu33-Leu342
- Molecular Weight:
- 45-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02863
