Recombinant Mouse LRG1 Protein
Product Sizes
10 ug
£127.00
RP02863-10UG
20 ug
£175.00
RP02863-20UG
50 ug
£240.00
RP02863-50UG
100 ug
£336.00
RP02863-100UG
About this Product
- SKU:
- RP02863
- Additional Names:
- LRG1,HMFT1766,LRG
- Extra Details:
- Recombinant Mouse LRG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu33-Leu342) of mouse LRG1 (Accession #NP_084072.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Leu33-Leu342
- Molecular Weight:
- 34.72 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02863
