Recombinant Human Granzyme B/CTLA-1/GZMB Protein
Product Sizes
10 ug
£193.00
RP02860-10UG
20 ug
£258.00
RP02860-20UG
About this Product
- SKU:
- RP02860
- Additional Names:
- C11|CCPI|CGL-1|CGL1|CSP-B|CSPB|CTLA1|CTSGL1|GZMB|HLP|SECT
- Extra Details:
- Recombinant Human Granzyme B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly19-Tyr247) of human Granzyme B (Accession #NP_004122.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Gly19-Tyr247
- Molecular Weight:
- 26.57 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP02860
